быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TET1 Rabbit mAb (A21914)
- Описание
- Характеристики
-
Overview
Product name TET1 Rabbit mAb Catalog No. A21914 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51468 Background
Enables methylcytosine dioxygenase activity. Involved in several processes, including dendrite morphogenesis; inner cell mass cell differentiation; and protein O-linked glycosylation. Acts upstream of or within DNA demethylation; regulation of DNA methylation; and regulation of genetic imprinting. Located in nucleus. Is expressed in several structures, including brain; early conceptus; embryo ectoderm; lower urogenital tract; and reproductive system. Orthologous to human TET1 (tet methylcytosine dioxygenase 1).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse TET1 (NP_001240786.1). Sequence HNTKSFSSASSTSHLVKDESTDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSGAHSGANAAAGECTGTVQPAEVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPLLSNSQKLASCQVEDERHPEADEPQHPEDDNLPQLD Gene ID Swiss Prot Synonyms LCX; Cxxc6; mKIAA1676; D10Ertd17e; 2510010B09Rik Calculated MW 219kDa Observed MW 260kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples ESCS Cellular location nucleoplasm, nucleus 
Western blot analysis of extracts of ESCS cells, using TET1 antibody (A21914) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human testis using TET1 Rabbit mAb (A21914) at dilution of 1:1000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using TET1 Rabbit mAb (A21914) at dilution of 1:1000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse TET1 (NP_001240786.1). Isotype IgG