быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD44 Rabbit mAb (A21919)
- Описание
- Характеристики
-
Overview
Product name CD44 Rabbit mAb Catalog No. A21919 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0464 Background
The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD44 (P16070). Sequence NNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFST Gene ID Swiss Prot Synonyms IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1 Calculated MW 82kDa Observed MW 80kDa Applications
Reactivity Human Tested applications WB IHC-P FC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:500 - 1:1000
- FC 1:20 - 1:50
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Flow Cytometry Positive samples U-251 MG Cellular location Cell membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of U-251MG cells, using CD44 antibody (A21919) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry of paraffin-embedded human liver using CD44 Rabbit mAb (A21919) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human skin using CD44 Rabbit mAb (A21919) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD44 (P16070). KO Validated Validated Isotype IgG