быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HE4/WFDC2 Rabbit mAb (A21953)
- Описание
- Характеристики
-
Overview
Product name HE4/WFDC2 Rabbit mAb Catalog No. A21953 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53195 Background
This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-124 of human HE4/WFDC2 (NP_006094.3). Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF Gene ID Swiss Prot Synonyms HE4; WAP5; EDDM4; dJ461P17.6 Calculated MW 13kDa Observed MW 23kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples OVCAR3 Cellular location Secreted 
Western blot analysis of OVCAR3, using HE4/WFDC2 antibody (A21953) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-124 of human HE4/WFDC2 (NP_006094.3). Isotype IgG