быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
RBMX/hnRNP G Rabbit mAb (A21963)
- Описание
- Характеристики
-
Overview
Product name RBMX/hnRNP G Rabbit mAb Catalog No. A21963 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54054 Background
This gene belongs to the RBMY gene family which includes candidate Y chromosome spermatogenesis genes. This gene, an active X chromosome homolog of the Y chromosome RBMY gene, is widely expressed whereas the RBMY gene evolved a male-specific function in spermatogenesis. Pseudogenes of this gene, found on chromosomes 1, 4, 9, 11, and 6, were likely derived by retrotransposition from the original gene. Alternatively spliced transcript variants encoding different isoforms have been identified. A snoRNA gene (SNORD61) is found in one of its introns.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 292-391 of human RBMX/hnRNP G (NP_002130.2). Sequence RSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY Gene ID Swiss Prot Synonyms RNMX; HNRPG; HNRNPG; MRXS11; RBMXP1; RBMXRT; hnRNP-G Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, Mouse thymus, Rat brain Cellular location Nucleus 
Western blot analysis of various lysates, using RBMX/hnRNPG antibody (A21963) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 292-391 of human RBMX/hnRNP G (NP_002130.2). Isotype IgG