быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Sin3A Rabbit mAb (A21966)
- Описание
- Характеристики
-
Overview
Product name Sin3A Rabbit mAb Catalog No. A21966 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54250 Background
The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sin3A (NP_056292.1). Sequence MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQ Gene ID Swiss Prot Synonyms WITKOS; DEL15Q24; CHR15DELq24 Calculated MW 145kDa Observed MW 151kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293F, Mouse thymus Cellular location Histone deacetylase complex, Nucleolus, Nucleoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using Sin3A antibody (A21966) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sin3A (NP_056292.1). Isotype IgG