быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DRP1 Rabbit mAb (A21968)
- Описание
- Характеристики
-
Overview
Product name DRP1 Rabbit mAb Catalog No. A21968 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54410 Background
This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated in several neurological disorders, including Alzheimer's disease. Mutations in this gene are associated with the autosomal dominant disorder, encephalopathy, lethal, due to defective mitochondrial and peroxisomal fission (EMPF). Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 561-670 of human DRP1 (NP_036192.2). Sequence QDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAV Gene ID Swiss Prot Synonyms DLP1; DRP1; DVLP; EMPF; OPA5; EMPF1; DYMPLE; HDYNIV Calculated MW 82kDa Observed MW 78kDa、82kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:2000 - 1:6000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HeLa, PC-12, NIH/3T3 Cellular location Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Golgi apparatus, Membrane, Mitochondrion outer membrane, Peripheral membrane protein, Peroxisome, clathrin-coated pit, cytosol, secretory vesicle, synaptic vesicle membrane 
Western blot analysis of extracts of various cell lines, using DRP1 antibody (A21968) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of NIH/3T3 cells, using DRP1 antibody (A21968) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg DRP1 antibody (A21968). Western blot was performed from the immunoprecipitate using DRP1 antibody (A21968) at a dilution of 1:5000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 561-670 of human DRP1 (NP_036192.2). Isotype IgG