быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PDGFB Rabbit mAb (A22036)
- Описание
- Характеристики
-
Overview
Product name PDGFB Rabbit mAb Catalog No. A22036 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53713 Background
This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 142-241 of human PDGFB (NP_002599.1). Sequence RPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA Gene ID Swiss Prot Synonyms SIS; SSV; IBGC5; PDGF2; c-sis; PDGF-2 Calculated MW 27kDa Observed MW Refer to figures Applications
Reactivity Mouse Tested applications IF/ICC Recommended dilution - IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunofluorescence Positive samples NIH/3T3 Cellular location Secreted 
Immunofluorescence analysis of NIH/3T3 using PDGFB Rabbit mAb (A22036) at dilution of 1:200(40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 142-241 of human PDGFB (NP_002599.1). Isotype IgG







