быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD132/IL-2 R gamma Rabbit mAb (A22037)
- Описание
- Характеристики
-
Overview
Product name CD132/IL-2 R gamma Rabbit mAb Catalog No. A22037 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54566 Background
The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD132/IL-2 R gamma (NP_000197.1). Sequence TSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP Gene ID Swiss Prot Synonyms P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1 Calculated MW 42kDa Observed MW 50-70kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, Mouse spleen, Mouse thymus Cellular location Membrane, Cell surface 
Western blot analysis of extracts of various cell lines, using CD132/IL-2 R gamma antibody (A22037) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD132/IL-2 R gamma (NP_000197.1). Isotype IgG