быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HAO1/GOX Rabbit mAb (A22043)
- Описание
- Характеристики
-
Overview
Product name HAO1/GOX Rabbit mAb Catalog No. A22043 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53722 Background
This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HAO1/GOX (NP_060015.1). Sequence MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQS Gene ID Swiss Prot Synonyms GO; GOX; GOX1; HAOX1 Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse liver Cellular location Peroxisome 
Western blot analysis of extracts of Mouse liver, using HAO1/GOX antibody (A22043) at1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using HAO1/GOX Rabbit mAb (A22043) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using HAO1/GOX Rabbit mAb (A22043) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HAO1/GOX (NP_060015.1). Isotype IgG