быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cathepsin G Rabbit mAb (A22047)
- Описание
- Характеристики
-
Overview
Product name Cathepsin G Rabbit mAb Catalog No. A22047 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54789 Background
The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. In addition, the encoded protein is antimicrobial, with bacteriocidal activity against S. aureus and N. gonorrhoeae. Transcript variants utilizing alternative polyadenylation signals exist for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 156-255 of human Cathepsin G (NP_001902.1). Sequence TDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL Gene ID Swiss Prot Synonyms CG; CATG Calculated MW 29kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IF/ICC Recommended dilution - IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunofluorescence Positive samples Cellular location Cell surface 
Immunofluorescence analysis of THP-1 using Cathepsin G Rabbit mAb (A22047) at dilution of 1:200(40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 156-255 of human Cathepsin G (NP_001902.1). Isotype IgG