быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cathepsin G Rabbit mAb (A22048)
- Описание
- Характеристики
-
Overview
Product name Cathepsin G Rabbit mAb Catalog No. A22048 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54792 Background
The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. In addition, the encoded protein is antimicrobial, with bacteriocidal activity against S. aureus and N. gonorrhoeae. Transcript variants utilizing alternative polyadenylation signals exist for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 156-255 of human Cathepsin G (NP_001902.1). Sequence TDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL Gene ID Swiss Prot Synonyms CG; CATG Calculated MW 29kDa Observed MW 29kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples THP-1, Mouse spleen, Rat spleen, Rat thymus Cellular location Cell surface 
Western blot analysis of extracts of THP-1 cells, using Cathepsin G antibody (A22048) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts of various lysates, using Cathepsin G Rabbit mAb (A22048) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 156-255 of human Cathepsin G (NP_001902.1). Isotype IgG