быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GLP2R Rabbit mAb (A22049)
- Описание
- Характеристики
-
Overview
Product name GLP2R Rabbit mAb Catalog No. A22049 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54969 Background
This gene encodes a G protein-coupled receptor that is closely related to the glucagon receptor and binds to glucagon-like peptide-2 (GLP2). Signalling through GLP2 stimulates intestinal growth and increases villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-553 of human GLP2R (NP_004237.1). Sequence SGCRACVLGKDFRFLGKCPKKLSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEESEI Gene ID Swiss Prot Synonyms GLP2R Calculated MW 63kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, HeLa, Mouse brain, Rat brain, Rat liver Cellular location Cell membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using GLP2R Rabbit mAb (A22049) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-553 of human GLP2R (NP_004237.1). Isotype IgG