быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Rev-erb beta/NR1D2 Rabbit mAb (A22050)
- Описание
- Характеристики
-
Overview
Product name Rev-erb beta/NR1D2 Rabbit mAb Catalog No. A22050 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54887 Background
This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Rev-erb beta/NR1D2 (NP_005117.3). Sequence ALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH Gene ID Swiss Prot Synonyms RVR; BD73; EAR-1R; REVERBB; REVERBbeta Calculated MW 65kDa Observed MW 70kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse lung, Rat lung, Mouse skeletal muscle Cellular location cytoplasm, nucleoplasm, nucleus 
Western blot analysis of various lysates, using Rev-erb beta/NR1D2 Rabbit mAb (A22050) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Rev-erb beta/NR1D2 (NP_005117.3). Isotype IgG