быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Chk1 Rabbit mAb (A22055)
- Описание
- Характеристики
-
Overview
Product name Chk1 Rabbit mAb Catalog No. A22055 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52506 Background
The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Chk1 (NP_001107593.1). Sequence PSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP Gene ID Swiss Prot Synonyms CHK1 Calculated MW 54kDa Observed MW 56kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562 Cellular location centrosome, condensed nuclear chromosome, cytoplasm, cytosol, extracellular space, nucleoplasm, nucleus 
Western blot analysis of extracts of K-562 cells, using Chk1 antibody (A22055) at1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Chk1 (NP_001107593.1). Isotype IgG