быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PTPIP51/RMDN3 Rabbit mAb (A22057)
- Описание
- Характеристики
-
Overview
Product name PTPIP51/RMDN3 Rabbit mAb Catalog No. A22057 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54933 Background
Enables microtubule binding activity. Involved in cellular calcium ion homeostasis. Located in several cellular components, including intercellular bridge; mitochondrial outer membrane; and spindle.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PTPIP51/RMDN3 (NP_060615.1). Sequence VSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY Gene ID Swiss Prot Synonyms RMD3; RMD-3; FAM82C; FAM82A2; ptpip51 Calculated MW 52kDa Observed MW 52kDa Applications
Reactivity Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Rat lung Cellular location Cytoplasm, Mitochondrion membrane, Mitochondrion outer membrane, Nucleus, Single-pass membrane protein, cytoskeleton, spindle, spindle pole 
Western blot analysis of extracts of various cell lines, using PTPIP51/RMDN3 antibody (A22057) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PTPIP51/RMDN3 (NP_060615.1). Isotype IgG