быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MLLT3/AF9 Rabbit mAb (A22072)
- Описание
- Характеристики
-
Overview
Product name MLLT3/AF9 Rabbit mAb Catalog No. A22072 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51958 Background
Enables chromatin binding activity and lysine-acetylated histone binding activity. Involved in several processes, including hematopoietic stem cell differentiation; positive regulation of transcription, DNA-templated; and regulation of stem cell division. Acts upstream of or within negative regulation of canonical Wnt signaling pathway and positive regulation of Wnt signaling pathway, planar cell polarity pathway. Located in cytosol and nucleoplasm. Part of transcription elongation factor complex.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human MLLT3/AF9 (NP_004520.2). Sequence MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSS Gene ID Swiss Prot Synonyms AF9; YEATS3 Calculated MW 63kDa Observed MW 72kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HEL Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using MLLT3/AF9 antibody (A22072) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human MLLT3/AF9 (NP_004520.2). Isotype IgG