быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NPPA Rabbit mAb (A22075)
- Описание
- Характеристики
-
Overview
Product name NPPA Rabbit mAb Catalog No. A22075 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51463 Background
The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. This gene is located adjacent to another member of the natriuretic family of peptides on chromosome 1.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NPPA (NP_006163.1). Sequence MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG Gene ID Swiss Prot Synonyms ANF; ANP; CDD; CDP; PND; ATFB6; ATRST2; CDD-ANF Calculated MW 16kDa Observed MW 16kDa Applications
Reactivity Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Rat heart Cellular location Secreted 
Western blot analysis of extracts of Rat heart, using NPPA antibody (A22075) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.
Immunofluorescence analysis of mouse heart using NPPA Rabbit mAb (A22075) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NPPA (NP_006163.1). Isotype IgG







