быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DAO Rabbit mAb (A22081)
- Описание
- Характеристики
-
Overview
Product name DAO Rabbit mAb Catalog No. A22081 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54988 Background
This gene encodes the peroxisomal enzyme D-amino acid oxidase. The enzyme is a flavoprotein which uses flavin adenine dinucleotide (FAD) as its prosthetic group. Its substrates include a wide variety of D-amino acids, but it is inactive on the naturally occurring L-amino acids. Its biological function is not known; it may act as a detoxifying agent which removes D-amino acids that accumulate during aging. In mice, it degrades D-serine, a co-agonist of the NMDA receptor. This gene may play a role in the pathophysiology of schizophrenia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAO (NP_001908.3). Sequence MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHE Gene ID Swiss Prot Synonyms DAAO; OXDA; DAMOX Calculated MW 39kDa Observed MW 39kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, A-549, Mouse brain, Rat brain Cellular location Peroxisome 
Western blot analysis of extracts of various cell lines, using DAO antibody (A22081) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of various cell lines, using DAO antibody (A22081) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAO (NP_001908.3). Isotype IgG