быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IL10 Rabbit mAb (A22083)
- Описание
- Характеристики
-
Overview
Product name IL10 Rabbit mAb Catalog No. A22083 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55175 Background
This gene encodes an anti-inflammatory cytokine that is a member of the class-2 cytokine family. The encoded protein is secreted by cells of both the innate and adaptive immune systems and is crucial for limiting the immune response to a broad range of pathogens. It also has been shown to suppress autoimmune responses. This protein mediates it's immunosuppressive signal through a specific interleukin 10 receptor complex. Aberrant functioning of this gene is associated with numerous immune disorders including graft-versus-host disease, and increased susceptibility to HIV-1 infection and rheumatoid arthritis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-178 of mouse IL10 (NP_034678.1). Sequence SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS Gene ID Swiss Prot Synonyms CSIF; If2a; Il-10 Calculated MW 21kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Extracellular space 
Immunohistochemistry analysis of paraffin-embedded human lung using IL10 Rabbit mAb (A22083) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using IL10 Rabbit mAb (A22083) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-178 of mouse IL10 (NP_034678.1). Isotype IgG