быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Collagen I/COL1A1 Rabbit mAb (A22090)
- Описание
- Характеристики
-
Overview
Product name Collagen I/COL1A1 Rabbit mAb Catalog No. A22090 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53610 Background
This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1151-1250 of human Collagen I/COL1A1 (NP_000079.2). Sequence GKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEG Gene ID Swiss Prot Synonyms OI1; OI2; OI3; OI4; EDSC; CAFYD; EDSARTH1 Calculated MW 139kDa Observed MW 220kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples NIH/3T3 Cellular location Secreted, extracellular matrix, extracellular space 
Western blot analysis of extracts of NIH/3T3 cells, using Collagen I/COL1A1 antibody (A22090) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Collagen I/COL1A1 Rabbit mAb (A22090) at dilution of 1:500(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse lung using Collagen I/COL1A1 Rabbit mAb (A22090) at dilution of 1:500(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using Collagen I/COL1A1 Rabbit mAb (A22090) at dilution of 1:500(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of NIH-3T3 cells using Collagen I/COL1A1 Rabbit mAb (A22090, dilution 1:200)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1151-1250 of human Collagen I/COL1A1 (NP_000079.2). Isotype IgG