быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MITF Rabbit mAb (A22091)
- Описание
- Характеристики
-
Overview
Product name MITF Rabbit mAb Catalog No. A22091 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55801 Background
The protein encoded by this gene is a transcription factor that contains both basic helix-loop-helix and leucine zipper structural features. The encoded protein regulates melanocyte development and is responsible for pigment cell-specific transcription of the melanogenesis enzyme genes. Heterozygous mutations in the this gene cause auditory-pigmentary syndromes, such as Waardenburg syndrome type 2 and Tietz syndrome.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 402-526 of human MITF (NP_001341533.1). Sequence HGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC Gene ID Swiss Prot Synonyms MI; WS2; CMM8; WS2A; COMMAD; MITF-A; bHLHe32 Calculated MW 59kDa Observed MW 50-75kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:2000 - 1:20000
- IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Rat heart Cellular location Nucleus, Cytoplasm 
Western blot analysis of extracts of Hela cells, using MITF antibody (A22091) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of Rat heart, using MITF antibody (A22091) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of HeLa using MITF Rabbit mAb (A22091) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 402-526 of human MITF (NP_001341533.1). Isotype IgG