быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cathepsin E (CTSE) Rabbit mAb (A22092)
- Описание
- Характеристики
-
Overview
Product name Cathepsin E (CTSE) Rabbit mAb Catalog No. A22092 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55299 Background
This gene encodes a member of the A1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme, an aspartic endopeptidase, may be involved in antigen processing and the maturation of secretory proteins. Elevated expression of this gene has been observed in neurodegeneration.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 132-244 of human Cathepsin E (CTSE) (NP_001901.1). Sequence GQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGS Gene ID Swiss Prot Synonyms CATE Calculated MW 43kDa Observed MW 45kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse stomach, Mouse spleen, Rat lung Cellular location Endosome 
Western blot analysis of extracts from rat lung, using Cathepsin E (CTSE) antibody (A22092) at1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.
Western blot analysis of extracts of various cell lines, using Cathepsin E (CTSE) antibody (A22092) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 132-244 of human Cathepsin E (CTSE) (NP_001901.1). Isotype IgG