быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ANKRD1 Rabbit mAb (A22096)
- Описание
- Характеристики
-
Overview
Product name ANKRD1 Rabbit mAb Catalog No. A22096 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55783 Background
The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ANKRD1 (NP_055206.2). Sequence MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE Gene ID Swiss Prot Synonyms ALRP; CARP; C-193; CVARP; MCARP; bA320F15.2 Calculated MW 36kDa Observed MW 36kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HUVEC, Rat heart Cellular location Nucleus matrix 
Western blot analysis of extracts of various cell lines, using ANKRD1 antibody (A22096) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ANKRD1 (NP_055206.2). Isotype IgG