быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cyclin D1 Rabbit mAb (A22104)
- Описание
- Характеристики
-
Overview
Product name Cyclin D1 Rabbit mAb Catalog No. A22104 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51669 Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of human cancers.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Cyclin D1 (NP_444284.1). Sequence WNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQ Gene ID Swiss Prot Synonyms BCL1; PRAD1; U21B31; D11S287E Calculated MW 34kDa Observed MW 35kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples C6, Mouse lung Cellular location Cytoplasm, Membrane, Nucleus 
Western blot analysis of various lysates, using Cyclin D1 antibody (A22104) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Cyclin D1 (NP_444284.1). Isotype IgG







