быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GluR2/GRIA2 Rabbit mAb (A22128)
- Описание
- Характеристики
-
Overview
Product name GluR2/GRIA2 Rabbit mAb Catalog No. A22128 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53741 Background
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels. These channels are assembled from 4 related subunits, GRIA1-4. The subunit encoded by this gene (GRIA2) is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to render the channel impermeable to Ca(2+). Human and animal studies suggest that pre-mRNA editing is essential for brain function, and defective GRIA2 RNA editing at the Q/R site may be relevant to amyotrophic lateral sclerosis (ALS) etiology. Alternative splicing, resulting in transcript variants encoding different isoforms, (including the flip and flop isoforms that vary in their signal transduction properties), has been noted for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR2/GRIA2 (NP_001077088.2). Sequence CLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGK Gene ID Swiss Prot Synonyms GLUR2; GLURB; GluA2; HBGR2; NEDLIB; gluR-2; gluR-B; GluR-K2 Calculated MW 99kDa Observed MW 100kDa Applications
Reactivity Human, Rat, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:2000- 1:10000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse brain, Rat brain Cellular location Cell membrane, Endoplasmic reticulum membrane, Postsynaptic cell membrane, Postsynaptic density membrane 
Western blot analysis of various lysates, using GluR2/GRIA2 antibody (A22128) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human brain using GluR2/GRIA2 antibody (A22128) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR2/GRIA2 (NP_001077088.2). Isotype IgG







