быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
S100A9 Rabbit mAb (A22131)
- Описание
- Характеристики
-
Overview
Product name S100A9 Rabbit mAb Catalog No. A22131 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55864 Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human S100A9 (NP_002956.1). Sequence MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Gene ID Swiss Prot Synonyms MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387; S100-A9 Calculated MW 13kDa Observed MW 14kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples THP-1 Cellular location cell junction, cytoplasm, cytoskeleton, cytosol, extracellular exosome, extracellular region, extracellular space, nucleoplasm, nucleus, plasma membrane 
Western blot analysis of various lysates, using S100A9 antibody (A22131) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using S100A9 antibody (A22131) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human lung using S100A9 antibody (A22131) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human S100A9 (NP_002956.1). Isotype IgG