быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Kallistatin (SERPINA4) Rabbit mAb (A22138)
- Описание
- Характеристики
-
Overview
Product name Kallistatin (SERPINA4) Rabbit mAb Catalog No. A22138 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55910 Background
Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Located in extracellular exosome. Biomarker of diabetic retinopathy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Kallistatin (SERPINA4) (NP_006206.2). Sequence MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQ Gene ID Swiss Prot Synonyms KAL; KST; PI4; KLST; PI-4; kallistatin Calculated MW 49kDa Observed MW 49kDa Applications
Reactivity Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Rat plasma Cellular location extracellular exosome, extracellular region, extracellular space 
Western blot analysis of Rat plasma, using Kallistatin (SERPINA4) antibody (A22138) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Kallistatin (SERPINA4) (NP_006206.2). Isotype IgG