быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HNF1α Rabbit mAb (A22139)
- Описание
- Характеристики
-
Overview
Product name HNF1α Rabbit mAb Catalog No. A22139 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55848 Background
The protein encoded by this gene is a transcription factor required for the expression of several liver-specific genes. The encoded protein functions as a homodimer and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human HNF1α (NP_000536.6). Sequence GEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNI Gene ID Swiss Prot Synonyms HNF1; LFB1; TCF1; HNF4A; MODY3; TCF-1; HNF-1A; IDDM20; HNF1alpha; HNF-1-alpha Calculated MW 67kDa Observed MW 81kDa Applications
Reactivity Human, Mouse, Rat Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Cytoplasm, Nucleus 
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using HNF1α antibody (A22139) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human kidney using HNF1α antibody (A22139) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer using HNF1α antibody (A22139) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using HNF1α antibody (A22139) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human HNF1α (NP_000536.6). Isotype IgG