быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD71/Transferrin Receptor Rabbit mAb (A22161)
- Описание
- Характеристики
-
Overview
Product name CD71/Transferrin Receptor Rabbit mAb Catalog No. A22161 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54396 Background
This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71/Transferrin Receptor (NP_003225.2). Sequence RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV Gene ID Swiss Prot Synonyms T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46 Calculated MW 85kDa Observed MW 90kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:10000 - 1:90000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, Mouse placenta, Rat placenta Cellular location basolateral plasma membrane, blood microparticle, cell surface, clathrin-coated pit, cytoplasmic vesicle, early endosome, endosome, external side of plasma membrane, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, melanosome, mitochondrion, nucleus, perinuclear region of cytoplasm, plasma membrane, recycling endosome 
Western blot analysis of HeLa, using CD71/Transferrin Receptor antibody (A22161) at1:80000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of various lysates, using CD71/Transferrin Receptor antibody (A22161) at1:80000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Mouse liver using CD71/Transferrin Receptor antibody (A22161) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of HeLa cells using CD71/Transferrin Receptor Rabbit mAb (A22161, dilution 1:200) (Red). The cells were counterstained with CD44 Rabbit mAb (A21919, dilution 1:200) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71/Transferrin Receptor (NP_003225.2). Isotype IgG