быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PAX8 Rabbit mAb (A22164)
- Описание
- Характеристики
-
Overview
Product name PAX8 Rabbit mAb Catalog No. A22164 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55538 Background
This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX8 (NP_003457.1). Sequence DSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD Gene ID Swiss Prot Synonyms PAX-8 Calculated MW 48kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IHC-P Recommended dilution - IHC-P 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Nucleus 
Immunohistochemistry analysis of paraffin-embedded human kidney using PAX8 Rabbit mAb (A22164) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PAX8 Rabbit mAb (A22164) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX8 (NP_003457.1). KO Validated Validated Isotype IgG