быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PCK1 Rabbit mAb (A22172)
- Описание
- Характеристики
-
Overview
Product name PCK1 Rabbit mAb Catalog No. A22172 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56074 Background
This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 523-622 of human PCK1 (NP_002582.3). Sequence GKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM Gene ID Swiss Prot Synonyms PCKDC; PEPCK1; PEPCKC; PEPCK-C Calculated MW 69kDa Observed MW 69kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2, Mouse kidney, Rat kidney Cellular location Cytoplasm 
Western blot analysis of various lysates, using PCK1 antibody (A22172) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Western blot analysis of HepG2, using PCK1 antibody (A22172) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 523-622 of human PCK1 (NP_002582.3). Isotype IgG