быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
N-Myc/MYCN Rabbit mAb (A22175)
- Описание
- Характеристики
-
Overview
Product name N-Myc/MYCN Rabbit mAb Catalog No. A22175 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55217 Background
This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human N-Myc/MYCN (NP_005369.2). Sequence MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG Gene ID Swiss Prot Synonyms NMYC; ODED; MODED; N-myc; bHLHe37; MYCNsORF; MYCNsPEP Calculated MW 50kDa Observed MW 60kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:1000-1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Neuro-2a Cellular location Nucleus 
Western blot analysis of extracts from Neuro-2a, using N-Myc/MYCN Rabbit mAb (A22175) at1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human N-Myc/MYCN (NP_005369.2). Isotype IgG