быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180)
- Описание
- Характеристики
-
Overview
Product name Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb Catalog No. A22180 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53641 Background
The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Non-phospho (Active)β-Catenin -S33/S37/T41 (NP_001895.1). Sequence MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP Gene ID Swiss Prot Synonyms EVR7; CTNNB; MRD19; NEDSDV; armadillo Calculated MW 85kDa Observed MW 92kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:2000 - 1:20000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, Mouse brain, Rat brain, C6, 293T, NIH-3T3 Cellular location Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole 
Western blot analysis of extracts of various lysates, using Non-phospho (Active)β-Catenin -S33/S37/T41 antibody (A22180) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of HeLa, using Non-phospho (Active)β-Catenin -S33/S37/T41 antibody (A22180) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry of paraffin-embedded human breast cancer using Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon carcinoma using Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human tonsil using Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Non-phospho (Active)β-Catenin -S33/S37/T41 (NP_001895.1). KO Validated Validated Isotype IgG