быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MAPKAPK-2/MK2 Rabbit mAb (A22183)
- Описание
- Характеристики
-
Overview
Product name MAPKAPK-2/MK2 Rabbit mAb Catalog No. A22183 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55427 Background
This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPKAPK-2/MK2 (NP_116584.2). Sequence MLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH Gene ID Swiss Prot Synonyms MK2; MK-2; MAPKAP-K2 Calculated MW 46kDa Observed MW 47kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A-431 Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various lysates, using MAPKAPK-2/MK2 antibody (A22183) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPKAPK-2/MK2 (NP_116584.2). Isotype IgG







