быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PSMA/FOLH1 Rabbit mAb (A22212)
- Описание
- Характеристики
-
Overview
Product name PSMA/FOLH1 Rabbit mAb Catalog No. A22212 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56326 Background
This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PSMA/FOLH1 (NP_004467.1). Sequence TNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPG Gene ID Swiss Prot Synonyms PSM; FGCP; FOLH; GCP2; PSMA; mGCP; GCPII; NAALAD1 Calculated MW 84kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples LNCaP, Mouse brain, Mouse kidney, Rat brain, Rat spleen Cellular location cell surface, cytoplasm, extracellular exosome, plasma membrane 
Western blot analysis of LNCaP, using PSMA/FOLH1 antibody (A22212) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:2000000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates, using PSMA/FOLH1 antibody (A22212) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:2000000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PSMA/FOLH1 (NP_004467.1). Isotype IgG







