быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD8A Rabbit mAb (A22219)
- Описание
- Характеристики
-
Overview
Product name CD8A Rabbit mAb Catalog No. A22219 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55249 Background
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-182 of human CD8A (NP_001759.3). Sequence SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Gene ID Swiss Prot Synonyms CD8; p32; Leu2; CD8alpha Calculated MW 21kDa/25kDa/30kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Cell membrane, Secreted, Single-pass type I membrane protein 
Immunohistochemistry of paraffin-embedded human appendix using CD8A Rabbit mAb (A22219) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded human tonsil using CD8A Rabbit mAb (A22219) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-182 of human CD8A (NP_001759.3). KO Validated Validated Isotype IgG







