быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CPSF73 Rabbit mAb (A2222)
- Описание
- Характеристики
-
Overview
Product name CPSF73 Rabbit mAb Catalog No. A2222 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2567 Background
This gene encodes a member of the metallo-beta-lactamase family. The encoded protein is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3'-cleavage site AAUAAA prior to polyadenylation. It also cleaves after the pre-mRNA sequence ACCCA during histone 3'-end pre-mRNA processing.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 585-684 of human CPSF3 (Q9UKF6). Sequence LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH Gene ID Swiss Prot Synonyms CPSF73; NEDMHS; CPSF-73; NEDMHSN Calculated MW 77kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, SH-SY5Y, Mouse liver, Mouse kidney, Mouse uterus, Rat spleen Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using CPSF73 antibody (A2222) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of rat spleen, using CPSF73 antibody (A2222) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 585-684 of human CPSF3 (Q9UKF6). Isotype IgG