быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NKX2-1 Rabbit mAb (A22247)
- Описание
- Характеристики
-
Overview
Product name NKX2-1 Rabbit mAb Catalog No. A22247 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51284 Background
This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias 'TTF1' with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human NKX2-1 (NP_003308.1). Sequence LEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASG Gene ID Swiss Prot Synonyms BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1 Calculated MW 39kDa Observed MW 42kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse lung Cellular location Nucleus 
Western blot analysis of Mouse lung, using NKX2-1 antibody (A22247) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human NKX2-1 (NP_003308.1). KO Validated Validated Isotype IgG







