быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CMTM6 Rabbit mAb (A22250)
- Описание
- Характеристики
-
Overview
Product name CMTM6 Rabbit mAb Catalog No. A22250 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53666 Background
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1). Sequence LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA Gene ID Swiss Prot Synonyms CKLFSF6; PRO2219 Calculated MW 20kDa Observed MW 20-22kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:10000 - 1:30000
- IF/ICC 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples U-937 Cellular location plasma membrane 
Western blot analysis of various lysates, using CMTM6 antibody (A22250) at1:30000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of Raw264.7 cells using CMTM6 antibody (A22250) at dilution of 1:1000 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1). Isotype IgG