быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IL1β Rabbit mAb (A22257)
- Описание
- Характеристики
-
Overview
Product name IL1β Rabbit mAb Catalog No. A22257 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56180 Background
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 118-269 of mouse IL1β (NP_032387.1). Sequence VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Gene ID Swiss Prot Synonyms Il-1b; IL-1beta Calculated MW 31kDa Observed MW 19kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Recombinant Mouse IL-1 beta Protein(500pg1ng) Cellular location cytosol, extracellular region, extracellular space, lysosome 
Western blot analysis of recombinant mouse IL-1 beta protein, using IL1β antibody (A22257) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 118-269 of mouse IL1β (NP_032387.1). Isotype IgG