быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Melan-A/MART-1 Rabbit mAb (A22259)
- Описание
- Характеристики
-
Overview
Product name Melan-A/MART-1 Rabbit mAb Catalog No. A22259 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55924 Background
Located in endoplasmic reticulum membrane; melanosome; and trans-Golgi network.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 11-110 of human MLANA (NP_005502.1). Sequence VLLLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP Gene ID Swiss Prot Synonyms MART1; MART-1 Calculated MW 13kDa Observed MW 20kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:2000 - 1:20000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples SK-MEL-28 Cellular location Endoplasmic reticulum membrane, Golgi apparatus, Melanosome, Single-pass type III membrane protein, trans-Golgi network membrane 
Western blot analysis of various lysates, using Melan-A/MART-1 antibody (A22259) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of SK-MEL-28 cells using Melan-A/MART-1 Rabbit mAb (A22259) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 11-110 of human MLANA (NP_005502.1). Isotype IgG