быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HDAC9 Rabbit mAb (A2226)
- Описание
- Характеристики
-
Overview
Product name HDAC9 Rabbit mAb Catalog No. A2226 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0735 Background
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC9 (Q9UKV0). Sequence MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELL Gene ID Swiss Prot Synonyms HD7; HD9; HD7b; HDAC; HDRP; MITR; HDAC7; HDAC7B; HDAC9B; HDAC9FL Calculated MW 111kDa Observed MW 150kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples RD, K-562 Cellular location Nucleus Customer validation WB(Mus musculus)
IF(Mus musculus)
Western blot analysis of various lysates, using HDAC9 Rabbit mAb (A2226) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat testis using HDAC9 Rabbit mAb (A2226) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using HDAC9 Rabbit mAb (A2226) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of U-2 OS cells using HDAC9 Rabbit mAb (A2226) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC9 (Q9UKV0). Isotype IgG