быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
COMP Rabbit mAb (A22260)
- Описание
- Характеристики
-
Overview
Product name COMP Rabbit mAb Catalog No. A22260 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54617 Background
The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Contraction or expansion of a 5 aa aspartate repeat and other mutations can cause pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human COMP (NP_000086.2). Sequence ELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFR Gene ID Swiss Prot Synonyms MED; CTS2; EDM1; EPD1; TSP5; PSACH; THBS5; TSP-5 Calculated MW 83kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HCT116, HepG2, Mouse testis, Rat testis Cellular location Secreted, extracellular matrix, extracellular space 
Western blot analysis of various lysates, using COMP antibody (A22260) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human COMP (NP_000086.2). Isotype IgG