быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
S100A7/Psoriasin Rabbit mAb (A22271)
- Описание
- Характеристики
-
Overview
Product name S100A7/Psoriasin Rabbit mAb Catalog No. A22271 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56869 Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2-101 of human S100A7/Psoriasin (NP_002954.2). Sequence SNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ Gene ID Swiss Prot Synonyms PSOR1; S100A7c Calculated MW 11kDa Observed MW 12kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples SK-BR-3 Cellular location Cytoplasm, Secreted 
Western blot analysis of SK-BR-3, using S100A7/Psoriasin antibody (A22271) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry of paraffin-embedded human tonsil using S100A7/Psoriasin Rabbit mAb (A22271) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2-101 of human S100A7/Psoriasin (NP_002954.2). Isotype IgG