быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NF-κB2 Rabbit mAb (A22279)
- Описание
- Характеристики
-
Overview
Product name NF-κB2 Rabbit mAb Catalog No. A22279 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57776 Background
This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NF-κB2 (NP_001070962.1). Sequence LRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH Gene ID Swiss Prot Synonyms p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100 Calculated MW 97kDa Observed MW 122kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, NIH/3T3, C6 Cellular location Cytoplasm, Nucleus 
Western blot analysis of various lysates, using NF-κB2 antibody (A22279) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NF-κB2 (NP_001070962.1). Isotype IgG







