быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
COX6B1 Rabbit mAb (A2228)
- Описание
- Характеристики
-
Overview
Product name COX6B1 Rabbit mAb Catalog No. A2228 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2568 Background
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-86 of human COX6B1 (P14854). Sequence MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI Gene ID Swiss Prot Synonyms COXG; COX6B; MC4DN7; COXVIb1 Calculated MW 10kDa Observed MW 10kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, SH-SY5Y Cellular location Mitochondrion intermembrane space 
Western blot analysis of extracts of various cell lines, using COX6B1 antibody (A2228) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human liver using COX6B1 Rabbit mAb (A2228) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-86 of human COX6B1 (P14854). Isotype IgG