быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SDHC Rabbit mAb (A22280)
- Описание
- Характеристики
-
Overview
Product name SDHC Rabbit mAb Catalog No. A22280 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55260 Background
This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SDHC (NP_002992.1). Sequence MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL Gene ID Swiss Prot Synonyms CYBL; PGL3; QPS1; SDH3; CYB560 Calculated MW 19kDa Observed MW 12kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:2000 - 1:20000
- IHC-P 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293F, HeLa, Mouse kidney, Rat liver, Rat heart Cellular location Mitochondrion inner membrane, Multi-pass membrane protein 
Western blot analysis of various lysates, using SDHC antibody (A22280) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human kidney using SDHC Rabbit mAb (A22280) at dilution of 1:300(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using SDHC Rabbit mAb (A22280) at dilution of 1:300(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using SDHC Rabbit mAb (A22280) at dilution of 1:300(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using SDHC Rabbit mAb (A22280) at dilution of 1:300(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of A431 cells using SDHC Rabbit mAb (A22280) at dilution of 1:100(40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using SDHC Rabbit mAb (A22280) at dilution of 1:100(40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using SDHC Rabbit mAb (A22280) at dilution of 1:100(40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SDHC (NP_002992.1). Isotype IgG