быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IL-1RAcP Rabbit mAb (A22286)
- Описание
- Характеристики
-
Overview
Product name IL-1RAcP Rabbit mAb Catalog No. A22286 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56983 Background
This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differing in their C-terminus. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 391-470 of human IL-1RAcP (NP_002173.1). Sequence AHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSP Gene ID Swiss Prot Synonyms IL1R3; C3orf13; IL-1RAcP Calculated MW 65kDa Observed MW 78kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples KARPAS-299, Mouse lung, Rat brain Cellular location Cell membrane, Secreted 
Western blot analysis of various lysates, using IL-1RAcP antibody (A22286) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of Rat brain, using IL-1RAcP antibody (A22286) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of Mouse lung, using IL-1RAcP antibody (A22286) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 391-470 of human IL-1RAcP (NP_002173.1). Isotype IgG