быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LATS1 Rabbit mAb (A22287)
- Описание
- Характеристики
-
Overview
Product name LATS1 Rabbit mAb Catalog No. A22287 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56891 Background
The protein encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late prophase phosphorylation remaining through metaphase. The N-terminal region of the protein binds CDC2 to form a complex showing reduced H1 histone kinase activity, indicating a role as a negative regulator of CDC2/cyclin A. In addition, the C-terminal kinase domain binds to its own N-terminal region, suggesting potential negative regulation through interference with complex formation via intramolecular binding. Biochemical and genetic data suggest a role as a tumor suppressor. This is supported by studies in knockout mice showing development of soft-tissue sarcomas, ovarian stromal cell tumors and a high sensitivity to carcinogenic treatments.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LATS1 (NP_004681.1). Sequence MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSE Gene ID Swiss Prot Synonyms wts; WARTS Calculated MW 127kDa Observed MW 150kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y Cellular location Cytoplasm, centrosome, cytoskeleton, microtubule organizing center 
Western blot analysis of SH-SY5Y, using LATS1 antibody (A22287) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LATS1 (NP_004681.1). Isotype IgG