быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IL10 Rabbit mAb (A22288)
- Описание
- Характеристики
-
Overview
Product name IL10 Rabbit mAb Catalog No. A22288 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56464 Background
Enables interleukin-10 receptor binding activity. Involved in several processes, including cellular response to estradiol stimulus; liver regeneration; and negative regulation of nitric oxide biosynthetic process. Located in extracellular space. Used to study several diseases, including lung disease (multiple); perinatal necrotizing enterocolitis; sciatic neuropathy; toxic encephalopathy; and transient cerebral ischemia. Biomarker of several diseases, including artery disease (multiple); decubitus ulcer; lung disease (multiple); obstructive sleep apnea; and postpartum depression. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); autoimmune disease (multiple); eye disease (multiple); gastrointestinal system cancer (multiple); and hematologic cancer (multiple). Orthologous to human IL10 (interleukin 10).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-178 of rat IL10 (NP_036986.2). Sequence SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN Gene ID Swiss Prot Synonyms If2a; IL10X Calculated MW 20kDa Observed MW 23kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Recombinant Mouse IL10 Protein Cellular location Cytoplasm 
Western blot analysis of various lysates, using IL10 antibody (A22288) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-178 of rat IL10 (NP_036986.2). Isotype IgG







